Protein Description: theg spermatid protein like
Gene Name: THEGL
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029248: 28%, ENSRNOG00000022598: 28%
Entrez Gene ID: 100506564
Uniprot ID: P0DJG4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: THEGL
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029248: 28%, ENSRNOG00000022598: 28%
Entrez Gene ID: 100506564
Uniprot ID: P0DJG4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | DGQVSTEISTCSEVFQKPIVLRILDTHRELEESEDPEKHENPEEPEEVREQDQRDESEECDEPHESYEPHAPYAPHKPRDSYAPYELHG |
Documents & Links for Anti THEGL pAb (ATL-HPA066627) | |
Datasheet | Anti THEGL pAb (ATL-HPA066627) Datasheet (External Link) |
Vendor Page | Anti THEGL pAb (ATL-HPA066627) at Atlas |
Documents & Links for Anti THEGL pAb (ATL-HPA066627) | |
Datasheet | Anti THEGL pAb (ATL-HPA066627) Datasheet (External Link) |
Vendor Page | Anti THEGL pAb (ATL-HPA066627) |