Anti THAP4 pAb (ATL-HPA044982)
Atlas Antibodies
- SKU:
- ATL-HPA044982-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: THAP4
Alternative Gene Name: CGI-36
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026279: 93%, ENSRNOG00000018351: 93%
Entrez Gene ID: 51078
Uniprot ID: Q8WY91
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | EPLSWMLGTWLSDPPGAGTYPTLQPFQYLEEVHISHVGQPMLNFSFNSFHPDTRKPMHRECGFIRLKPDTNKVAFVSAQNTGVVEVEEGEVNGQELCIASHS |
Gene Sequence | EPLSWMLGTWLSDPPGAGTYPTLQPFQYLEEVHISHVGQPMLNFSFNSFHPDTRKPMHRECGFIRLKPDTNKVAFVSAQNTGVVEVEEGEVNGQELCIASHS |
Gene ID - Mouse | ENSMUSG00000026279 |
Gene ID - Rat | ENSRNOG00000018351 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti THAP4 pAb (ATL-HPA044982) | |
Datasheet | Anti THAP4 pAb (ATL-HPA044982) Datasheet (External Link) |
Vendor Page | Anti THAP4 pAb (ATL-HPA044982) at Atlas Antibodies |
Documents & Links for Anti THAP4 pAb (ATL-HPA044982) | |
Datasheet | Anti THAP4 pAb (ATL-HPA044982) Datasheet (External Link) |
Vendor Page | Anti THAP4 pAb (ATL-HPA044982) |