Anti THAP11 pAb (ATL-HPA072537)

Atlas Antibodies

Catalog No.: ATL-HPA072537-25

Protein Description: THAP domain containing 11
Gene Name: THAP11
Alternative Gene Name: CTG-B43a, CTG-B45d, HRIHFB2206
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036442: 100%, ENSRNOG00000019109: 100%
Entrez Gene ID: 57215
Uniprot ID: Q96EK4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: CVPGCYNNSHRDKALHFYTFPKDAELRRLWLKNVSRAGVSGCFSTFQPTTGHRLCSVHF
• Gene Sequence: CVPGCYNNSHRDKALHFYTFPKDAELRRLWLKNVSRAGVSGCFSTFQPTTGHRLCSVHF
• Gene ID - Mouse: ENSMUSG00000036442
• Gene ID - Rat: ENSRNOG00000019109
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.