Anti THAP11 pAb (ATL-HPA072537)

Atlas Antibodies

Catalog No.:
ATL-HPA072537-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: THAP domain containing 11
Gene Name: THAP11
Alternative Gene Name: CTG-B43a, CTG-B45d, HRIHFB2206
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036442: 100%, ENSRNOG00000019109: 100%
Entrez Gene ID: 57215
Uniprot ID: Q96EK4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen CVPGCYNNSHRDKALHFYTFPKDAELRRLWLKNVSRAGVSGCFSTFQPTTGHRLCSVHF
Gene Sequence CVPGCYNNSHRDKALHFYTFPKDAELRRLWLKNVSRAGVSGCFSTFQPTTGHRLCSVHF
Gene ID - Mouse ENSMUSG00000036442
Gene ID - Rat ENSRNOG00000019109
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti THAP11 pAb (ATL-HPA072537)
Datasheet Anti THAP11 pAb (ATL-HPA072537) Datasheet (External Link)
Vendor Page Anti THAP11 pAb (ATL-HPA072537) at Atlas Antibodies

Documents & Links for Anti THAP11 pAb (ATL-HPA072537)
Datasheet Anti THAP11 pAb (ATL-HPA072537) Datasheet (External Link)
Vendor Page Anti THAP11 pAb (ATL-HPA072537)