Protein Description: THAP domain containing 11
Gene Name: THAP11
Alternative Gene Name: CTG-B43a, CTG-B45d, HRIHFB2206
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036442: 100%, ENSRNOG00000019109: 100%
Entrez Gene ID: 57215
Uniprot ID: Q96EK4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: THAP11
Alternative Gene Name: CTG-B43a, CTG-B45d, HRIHFB2206
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036442: 100%, ENSRNOG00000019109: 100%
Entrez Gene ID: 57215
Uniprot ID: Q96EK4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | CVPGCYNNSHRDKALHFYTFPKDAELRRLWLKNVSRAGVSGCFSTFQPTTGHRLCSVHF |
Documents & Links for Anti THAP11 pAb (ATL-HPA072537) | |
Datasheet | Anti THAP11 pAb (ATL-HPA072537) Datasheet (External Link) |
Vendor Page | Anti THAP11 pAb (ATL-HPA072537) at Atlas |
Documents & Links for Anti THAP11 pAb (ATL-HPA072537) | |
Datasheet | Anti THAP11 pAb (ATL-HPA072537) Datasheet (External Link) |
Vendor Page | Anti THAP11 pAb (ATL-HPA072537) |