Protein Description: THAP domain containing 10
Gene Name: THAP10
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039759: 33%, ENSRNOG00000026840: 33%
Entrez Gene ID: 56906
Uniprot ID: Q9P2Z0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: THAP10
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039759: 33%, ENSRNOG00000026840: 33%
Entrez Gene ID: 56906
Uniprot ID: Q9P2Z0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | CRADWYGGNDRSVICSDHFAPACFDVSSVIQKNLRFSQRLRLVAGAVPTLHRVPAPAPKRGEEGDQAGRLDTRGELQAAR |
| Documents & Links for Anti THAP10 pAb (ATL-HPA073220) | |
| Datasheet | Anti THAP10 pAb (ATL-HPA073220) Datasheet (External Link) |
| Vendor Page | Anti THAP10 pAb (ATL-HPA073220) at Atlas |
| Documents & Links for Anti THAP10 pAb (ATL-HPA073220) | |
| Datasheet | Anti THAP10 pAb (ATL-HPA073220) Datasheet (External Link) |
| Vendor Page | Anti THAP10 pAb (ATL-HPA073220) |