Protein Description: transforming growth factor beta 1
Gene Name: TGFB1
Alternative Gene Name: CED, DPD1, TGFB, TGFbeta
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000002603: 80%, ENSRNOG00000020652: 80%
Entrez Gene ID: 7040
Uniprot ID: P01137
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: TGFB1
Alternative Gene Name: CED, DPD1, TGFB, TGFbeta
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000002603: 80%, ENSRNOG00000020652: 80%
Entrez Gene ID: 7040
Uniprot ID: P01137
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | EWLSFDVTGVVRQWLSRGGEIEGFRLSAHCSCDSRDNTLQVDINGFTTGRRGDLATIHGMNRPFLLLMATPLERAQHLQSSRHR |
| Documents & Links for Anti TGFB1 pAb (ATL-HPA073356) | |
| Datasheet | Anti TGFB1 pAb (ATL-HPA073356) Datasheet (External Link) |
| Vendor Page | Anti TGFB1 pAb (ATL-HPA073356) at Atlas |
| Documents & Links for Anti TGFB1 pAb (ATL-HPA073356) | |
| Datasheet | Anti TGFB1 pAb (ATL-HPA073356) Datasheet (External Link) |
| Vendor Page | Anti TGFB1 pAb (ATL-HPA073356) |