Anti TGFB1 pAb (ATL-HPA073356)

Atlas Antibodies

SKU:
ATL-HPA073356-25
  • Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol & the Golgi apparatus.
Shipping:
Calculated at Checkout
$328.00
Adding to cart… The item has been added
Protein Description: transforming growth factor beta 1
Gene Name: TGFB1
Alternative Gene Name: CED, DPD1, TGFB, TGFbeta
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000002603: 80%, ENSRNOG00000020652: 80%
Entrez Gene ID: 7040
Uniprot ID: P01137
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EWLSFDVTGVVRQWLSRGGEIEGFRLSAHCSCDSRDNTLQVDINGFTTGRRGDLATIHGMNRPFLLLMATPLERAQHLQSSRHR
Gene Sequence EWLSFDVTGVVRQWLSRGGEIEGFRLSAHCSCDSRDNTLQVDINGFTTGRRGDLATIHGMNRPFLLLMATPLERAQHLQSSRHR
Gene ID - Mouse ENSMUSG00000002603
Gene ID - Rat ENSRNOG00000020652
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti TGFB1 pAb (ATL-HPA073356)
Datasheet Anti TGFB1 pAb (ATL-HPA073356) Datasheet (External Link)
Vendor Page Anti TGFB1 pAb (ATL-HPA073356) at Atlas Antibodies

Documents & Links for Anti TGFB1 pAb (ATL-HPA073356)
Datasheet Anti TGFB1 pAb (ATL-HPA073356) Datasheet (External Link)
Vendor Page Anti TGFB1 pAb (ATL-HPA073356)