Anti TFPI2 pAb (ATL-HPA049158 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA049158-25

• 

Protein Description: tissue factor pathway inhibitor 2
Gene Name: TFPI2
Alternative Gene Name: PP5, REF1, TFPI-2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029664: 47%, ENSRNOG00000010513: 47%
Entrez Gene ID: 7980
Uniprot ID: P48307
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GNANNFYTWEACDDACWRIEKVPKVCRLQVSVDDQCEGSTEKYFFNLSSMTCE
• Gene Sequence: GNANNFYTWEACDDACWRIEKVPKVCRLQVSVDDQCEGSTEKYFFNLSSMTCE
• Gene ID - Mouse: ENSMUSG00000029664
• Gene ID - Rat: ENSRNOG00000010513
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.