Anti TFG pAb (ATL-HPA052206)

Atlas Antibodies

SKU:
ATL-HPA052206-25
  • Immunofluorescent staining of human cell line U-251 MG shows localization to vesicles.
  • Western blot analysis in human cell line RT-4, human cell line U-251 MG, human plasma and human liver tissue.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: TRK-fused gene
Gene Name: TFG
Alternative Gene Name: FLJ36137, SPG57, TF6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022757: 96%, ENSRNOG00000001633: 97%
Entrez Gene ID: 10342
Uniprot ID: Q92734
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LRRELIELRNKVNRLLDSLEPPGEPGPSTNIPENDTVDGREEKSASDSSGKQSTQVMAASMSAFDPLKNQDEINKNVMSAFGLTDDQVSGPPS
Gene Sequence LRRELIELRNKVNRLLDSLEPPGEPGPSTNIPENDTVDGREEKSASDSSGKQSTQVMAASMSAFDPLKNQDEINKNVMSAFGLTDDQVSGPPS
Gene ID - Mouse ENSMUSG00000022757
Gene ID - Rat ENSRNOG00000001633
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti TFG pAb (ATL-HPA052206)
Datasheet Anti TFG pAb (ATL-HPA052206) Datasheet (External Link)
Vendor Page Anti TFG pAb (ATL-HPA052206) at Atlas Antibodies

Documents & Links for Anti TFG pAb (ATL-HPA052206)
Datasheet Anti TFG pAb (ATL-HPA052206) Datasheet (External Link)
Vendor Page Anti TFG pAb (ATL-HPA052206)