Protein Description: transcription factor EC
Gene Name: TFEC
Alternative Gene Name: bHLHe34, TCFEC, TFECL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029553: 90%, ENSRNOG00000061595: 90%
Entrez Gene ID: 22797
Uniprot ID: O14948
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: TFEC
Alternative Gene Name: bHLHe34, TCFEC, TFECL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029553: 90%, ENSRNOG00000061595: 90%
Entrez Gene ID: 22797
Uniprot ID: O14948
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | AIAFSDPLSYFTDLSFSAALKEEQRLDGMLLDDTISPFGTDPLLSATSPAV |
Documents & Links for Anti TFEC pAb (ATL-HPA063577) | |
Datasheet | Anti TFEC pAb (ATL-HPA063577) Datasheet (External Link) |
Vendor Page | Anti TFEC pAb (ATL-HPA063577) at Atlas |
Documents & Links for Anti TFEC pAb (ATL-HPA063577) | |
Datasheet | Anti TFEC pAb (ATL-HPA063577) Datasheet (External Link) |
Vendor Page | Anti TFEC pAb (ATL-HPA063577) |