Protein Description: testis expressed 38
Gene Name: TEX38
Alternative Gene Name: ATPAF1-AS1, C1orf223, LOC374973, THEG4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000044556: 83%, ENSRNOG00000010162: 81%
Entrez Gene ID: 374973
Uniprot ID: Q6PEX7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: TEX38
Alternative Gene Name: ATPAF1-AS1, C1orf223, LOC374973, THEG4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000044556: 83%, ENSRNOG00000010162: 81%
Entrez Gene ID: 374973
Uniprot ID: Q6PEX7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | HWRKNLRREEHAQQWVEVMRAATFTYSPLLYWINKRRRYGMNAAINTGPAPAVTKTETEVQNPDVLWDLD |
| Documents & Links for Anti TEX38 pAb (ATL-HPA073711) | |
| Datasheet | Anti TEX38 pAb (ATL-HPA073711) Datasheet (External Link) |
| Vendor Page | Anti TEX38 pAb (ATL-HPA073711) at Atlas |
| Documents & Links for Anti TEX38 pAb (ATL-HPA073711) | |
| Datasheet | Anti TEX38 pAb (ATL-HPA073711) Datasheet (External Link) |
| Vendor Page | Anti TEX38 pAb (ATL-HPA073711) |