Anti TERT pAb (ATL-HPA054641)

Atlas Antibodies

SKU: ATL-HPA054641-25

• 

Protein Description: telomerase reverse transcriptase
Gene Name: TERT
Alternative Gene Name: EST2, hEST2, TCS1, TP2, TRT
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021611: 49%, ENSRNOG00000025327: 57%
Entrez Gene ID: 7015
Uniprot ID: O14746
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GVLLKTHCPLRAAVTPAAGVCAREKPQGSVAAPEEEDTDPRRLVQLLRQHSSPWQVYGFVRACLRRLVPPGLWGSRHNERRFLRNTKKFISLGKHAKLS
• Gene Sequence: GVLLKTHCPLRAAVTPAAGVCAREKPQGSVAAPEEEDTDPRRLVQLLRQHSSPWQVYGFVRACLRRLVPPGLWGSRHNERRFLRNTKKFISLGKHAKLS
• Gene ID - Mouse: ENSMUSG00000021611
• Gene ID - Rat: ENSRNOG00000025327
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti TERT pAb (ATL-HPA054641) – 1 Found

Ayiomamitis, Georgios D; Notas, George; Vasilakaki, Thivi; Tsavari, Aikaterini; Vederaki, Styliani; Theodosopoulos, Theodosis; Kouroumalis, Elias; Zaravinos, Apostolos. Understanding the Interplay between COX-2 and hTERT in Colorectal Cancer Using a Multi-Omics Analysis. Cancers. 2019;11(10)