Anti TERF1 pAb (ATL-HPA048379)

Atlas Antibodies

SKU: ATL-HPA048379-25

• 

Protein Description: telomeric repeat binding factor (NIMA-interacting) 1
Gene Name: TERF1
Alternative Gene Name: PIN2, TRBF1, TRF, TRF1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025925: 36%, ENSRNOG00000007291: 42%
Entrez Gene ID: 7013
Uniprot ID: P54274
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: FLSKLQHGTQQQDLNKKERRVGTLQSTKKKKESRRATESRIPVSKSQPVTPE
• Gene Sequence: FLSKLQHGTQQQDLNKKERRVGTLQSTKKKKESRRATESRIPVSKSQPVTPE
• Gene ID - Mouse: ENSMUSG00000025925
• Gene ID - Rat: ENSRNOG00000007291
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.