Anti TENM3 pAb (ATL-HPA047043)

Atlas Antibodies

SKU:
ATL-HPA047043-25
  • Immunohistochemical staining of human placenta shows membranous positivity in trophoblastic cells.
  • Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.
  • Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10<br/>Lane 2: Human cell line U-2 OS
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: teneurin transmembrane protein 3
Gene Name: TENM3
Alternative Gene Name: KIAA1455, ODZ3, Ten-M3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031561: 94%, ENSRNOG00000012802: 95%
Entrez Gene ID: 55714
Uniprot ID: Q9P273
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EPSYELVKSQQWDDIPPIFGVQQQVARQAKAFLSLGKMAEVQVSRRRAGGAQSWLWFATVKSLIGKGVMLAVSQGRVQTNVLN
Gene Sequence EPSYELVKSQQWDDIPPIFGVQQQVARQAKAFLSLGKMAEVQVSRRRAGGAQSWLWFATVKSLIGKGVMLAVSQGRVQTNVLN
Gene ID - Mouse ENSMUSG00000031561
Gene ID - Rat ENSRNOG00000012802
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti TENM3 pAb (ATL-HPA047043)
Datasheet Anti TENM3 pAb (ATL-HPA047043) Datasheet (External Link)
Vendor Page Anti TENM3 pAb (ATL-HPA047043) at Atlas Antibodies

Documents & Links for Anti TENM3 pAb (ATL-HPA047043)
Datasheet Anti TENM3 pAb (ATL-HPA047043) Datasheet (External Link)
Vendor Page Anti TENM3 pAb (ATL-HPA047043)