Protein Description: tudor domain containing 3
Gene Name: TDRD3
Alternative Gene Name: FLJ21007
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022019: 75%, ENSRNOG00000009034: 80%
Entrez Gene ID: 81550
Uniprot ID: Q9H7E2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: TDRD3
Alternative Gene Name: FLJ21007
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022019: 75%, ENSRNOG00000009034: 80%
Entrez Gene ID: 81550
Uniprot ID: Q9H7E2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | PRFQRDSQNSKSVLEGSGLPRNRGSERPSTSSVSEVWAEDRIKCDRPYSRYDRTKDTSYPLGSQHSDGAFKKRDNSMQSRSGKGP |
Documents & Links for Anti TDRD3 pAb (ATL-HPA067153) | |
Datasheet | Anti TDRD3 pAb (ATL-HPA067153) Datasheet (External Link) |
Vendor Page | Anti TDRD3 pAb (ATL-HPA067153) at Atlas |
Documents & Links for Anti TDRD3 pAb (ATL-HPA067153) | |
Datasheet | Anti TDRD3 pAb (ATL-HPA067153) Datasheet (External Link) |
Vendor Page | Anti TDRD3 pAb (ATL-HPA067153) |