Anti TDRD15 pAb (ATL-HPA054675)

Atlas Antibodies

SKU:
ATL-HPA054675-25
  • Immunohistochemical staining of human bone marrow shows strong cytoplasmic positivity in subset of hematopoietic cells.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: tudor domain containing 15
Gene Name: TDRD15
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035390: 24%, ENSRNOG00000060052: 54%
Entrez Gene ID: 100129278
Uniprot ID: B5MCY1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PEELLNLPRLSYPCILYGILPAKGKHWSEEAKIFFRDFLSKPDLVFQFREYHSETKLKVDVIHEKNNLADILVASGLATYSKDSPHLDAITATES
Gene Sequence PEELLNLPRLSYPCILYGILPAKGKHWSEEAKIFFRDFLSKPDLVFQFREYHSETKLKVDVIHEKNNLADILVASGLATYSKDSPHLDAITATES
Gene ID - Mouse ENSMUSG00000035390
Gene ID - Rat ENSRNOG00000060052
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti TDRD15 pAb (ATL-HPA054675)
Datasheet Anti TDRD15 pAb (ATL-HPA054675) Datasheet (External Link)
Vendor Page Anti TDRD15 pAb (ATL-HPA054675) at Atlas Antibodies

Documents & Links for Anti TDRD15 pAb (ATL-HPA054675)
Datasheet Anti TDRD15 pAb (ATL-HPA054675) Datasheet (External Link)
Vendor Page Anti TDRD15 pAb (ATL-HPA054675)