Anti TDG pAb (ATL-HPA052263)

Atlas Antibodies

SKU: ATL-HPA052263-25

• 
• 

Protein Description: thymine-DNA glycosylase
Gene Name: TDG
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034674: 100%, ENSRNOG00000027124: 100%
Entrez Gene ID: 6996
Uniprot ID: Q13569
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: WKCLFMSGLSEVQLNHMDDHTLPGKYGIGFTNMVERTTPGSKDLSSKEFREGGRILVQKLQKYQPRIAVFNGKCIYEIFSKEVFGVKVKNLEFG
• Gene Sequence: WKCLFMSGLSEVQLNHMDDHTLPGKYGIGFTNMVERTTPGSKDLSSKEFREGGRILVQKLQKYQPRIAVFNGKCIYEIFSKEVFGVKVKNLEFG
• Gene ID - Mouse: ENSMUSG00000034674
• Gene ID - Rat: ENSRNOG00000027124
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti TDG pAb (ATL-HPA052263) – 1 Found

Malvi, Parmanand; Wang, Biao; Shah, Shreni; Gupta, Romi. Dissecting the role of RNA modification regulatory proteins in melanoma. Oncotarget. 2019;10(38):3745-3759.