Anti TCP11 pAb (ATL-HPA048311)

Atlas Antibodies

SKU:
ATL-HPA048311-25
  • Immunohistochemical staining of human testis shows strong cytoplasmic positivity in subset of cells in seminiferus ducts.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: t-complex 11, testis-specific
Gene Name: TCP11
Alternative Gene Name: D6S230E, FPPR, KIAA0229
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000058252: 78%, ENSRNOG00000011034: 81%
Entrez Gene ID: 6954
Uniprot ID: Q8WWU5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LILIEKELAELGWKFLNLMHHNQQVFGPYYAEILKH
Gene Sequence LILIEKELAELGWKFLNLMHHNQQVFGPYYAEILKH
Gene ID - Mouse ENSMUSG00000058252
Gene ID - Rat ENSRNOG00000011034
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti TCP11 pAb (ATL-HPA048311)
Datasheet Anti TCP11 pAb (ATL-HPA048311) Datasheet (External Link)
Vendor Page Anti TCP11 pAb (ATL-HPA048311) at Atlas Antibodies

Documents & Links for Anti TCP11 pAb (ATL-HPA048311)
Datasheet Anti TCP11 pAb (ATL-HPA048311) Datasheet (External Link)
Vendor Page Anti TCP11 pAb (ATL-HPA048311)