Anti TCEA3 pAb (ATL-HPA044960)
Atlas Antibodies
- SKU:
- ATL-HPA044960-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: TCEA3
Alternative Gene Name: TFIIS.H
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000001604: 84%, ENSRNOG00000011794: 85%
Entrez Gene ID: 6920
Uniprot ID: O75764
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | AESPKTPSSPLTPTFASSMCLLAPCYLTGDSVRDKCVEMLSAALKADDDYKDYGVNCDKMASEIEDH |
Gene Sequence | AESPKTPSSPLTPTFASSMCLLAPCYLTGDSVRDKCVEMLSAALKADDDYKDYGVNCDKMASEIEDH |
Gene ID - Mouse | ENSMUSG00000001604 |
Gene ID - Rat | ENSRNOG00000011794 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti TCEA3 pAb (ATL-HPA044960) | |
Datasheet | Anti TCEA3 pAb (ATL-HPA044960) Datasheet (External Link) |
Vendor Page | Anti TCEA3 pAb (ATL-HPA044960) at Atlas Antibodies |
Documents & Links for Anti TCEA3 pAb (ATL-HPA044960) | |
Datasheet | Anti TCEA3 pAb (ATL-HPA044960) Datasheet (External Link) |
Vendor Page | Anti TCEA3 pAb (ATL-HPA044960) |