Protein Description: T-box 5
Gene Name: TBX5
Alternative Gene Name: HOS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000018263: 96%, ENSRNOG00000001399: 95%
Entrez Gene ID: 6910
Uniprot ID: Q99593
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: TBX5
Alternative Gene Name: HOS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000018263: 96%, ENSRNOG00000001399: 95%
Entrez Gene ID: 6910
Uniprot ID: Q99593
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | PRLAGMANHGSPQLGEGMFQHQTSVAHQPVVRQCGPQTGLQSPGTLQPPEFLYSHGVPRTLSPHQYHSVHGVGMVPEWSDNS |
Documents & Links for Anti TBX5 pAb (ATL-HPA064683) | |
Datasheet | Anti TBX5 pAb (ATL-HPA064683) Datasheet (External Link) |
Vendor Page | Anti TBX5 pAb (ATL-HPA064683) at Atlas |
Documents & Links for Anti TBX5 pAb (ATL-HPA064683) | |
Datasheet | Anti TBX5 pAb (ATL-HPA064683) Datasheet (External Link) |
Vendor Page | Anti TBX5 pAb (ATL-HPA064683) |