Protein Description: T-box 3
Gene Name: TBX3
Alternative Gene Name: TBX3-ISO, UMS, XHL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000018604: 100%, ENSRNOG00000008706: 100%
Entrez Gene ID: 6926
Uniprot ID: O15119
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: TBX3
Alternative Gene Name: TBX3-ISO, UMS, XHL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000018604: 100%, ENSRNOG00000008706: 100%
Entrez Gene ID: 6926
Uniprot ID: O15119
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | MSLSMRDPVIPGTSMAYHPFLPHRAPDFAMSAVLGHQPPFFPALTLPPNGAAALSLPGALAKPIMDQLVGAAETGIPFSSLGPQAHLRPLKTMEP |
Documents & Links for Anti TBX3 pAb (ATL-HPA075876) | |
Datasheet | Anti TBX3 pAb (ATL-HPA075876) Datasheet (External Link) |
Vendor Page | Anti TBX3 pAb (ATL-HPA075876) at Atlas |
Documents & Links for Anti TBX3 pAb (ATL-HPA075876) | |
Datasheet | Anti TBX3 pAb (ATL-HPA075876) Datasheet (External Link) |
Vendor Page | Anti TBX3 pAb (ATL-HPA075876) |