Anti TBCK pAb (ATL-HPA051611)

Atlas Antibodies

SKU:
ATL-HPA051611-25
  • Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & nucleoli fibrillar center.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: TBC1 domain containing kinase
Gene Name: TBCK
Alternative Gene Name: HSPC302, MGC16169
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028030: 96%, ENSRNOG00000011454: 95%
Entrez Gene ID: 93627
Uniprot ID: Q8TEA7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KDKVFSEVSPLYTPFTKPASLFSSSLRCADLTLPEDISQLCKDINNDYLAERSIEEVYYLWCLAGGDLEKELVNKEIIRSKPPICTLPNFLFEDGESFGQGRDRSSLLDDTTVTLSLCQLRNRLKDVGGEAFYPLLED
Gene Sequence KDKVFSEVSPLYTPFTKPASLFSSSLRCADLTLPEDISQLCKDINNDYLAERSIEEVYYLWCLAGGDLEKELVNKEIIRSKPPICTLPNFLFEDGESFGQGRDRSSLLDDTTVTLSLCQLRNRLKDVGGEAFYPLLED
Gene ID - Mouse ENSMUSG00000028030
Gene ID - Rat ENSRNOG00000011454
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti TBCK pAb (ATL-HPA051611)
Datasheet Anti TBCK pAb (ATL-HPA051611) Datasheet (External Link)
Vendor Page Anti TBCK pAb (ATL-HPA051611) at Atlas Antibodies

Documents & Links for Anti TBCK pAb (ATL-HPA051611)
Datasheet Anti TBCK pAb (ATL-HPA051611) Datasheet (External Link)
Vendor Page Anti TBCK pAb (ATL-HPA051611)