Anti TBC1D2B pAb (ATL-HPA048174)
Atlas Antibodies
- SKU:
- ATL-HPA048174-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: TBC1D2B
Alternative Gene Name: KIAA1055
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037410: 75%, ENSRNOG00000014543: 77%
Entrez Gene ID: 23102
Uniprot ID: Q9UPU7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | DPTPKDLEESIVQEEKKKLTPEGNKGVTGSGFPFDFGRNPYKGKRPLKDIIGSYKNRHSSGDPSSEGTSGSGSVSIRKPASEMQLQVQSQQEELEQLKKD |
Gene Sequence | DPTPKDLEESIVQEEKKKLTPEGNKGVTGSGFPFDFGRNPYKGKRPLKDIIGSYKNRHSSGDPSSEGTSGSGSVSIRKPASEMQLQVQSQQEELEQLKKD |
Gene ID - Mouse | ENSMUSG00000037410 |
Gene ID - Rat | ENSRNOG00000014543 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti TBC1D2B pAb (ATL-HPA048174) | |
Datasheet | Anti TBC1D2B pAb (ATL-HPA048174) Datasheet (External Link) |
Vendor Page | Anti TBC1D2B pAb (ATL-HPA048174) at Atlas Antibodies |
Documents & Links for Anti TBC1D2B pAb (ATL-HPA048174) | |
Datasheet | Anti TBC1D2B pAb (ATL-HPA048174) Datasheet (External Link) |
Vendor Page | Anti TBC1D2B pAb (ATL-HPA048174) |