Anti TBC1D10A pAb (ATL-HPA076041)

Atlas Antibodies

SKU: ATL-HPA076041-25

• 

Protein Description: TBC1 domain family, member 10A
Gene Name: TBC1D10A
Alternative Gene Name: AC004997.C22.2, EPI64, TBC1D10
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034412: 65%, ENSRNOG00000006394: 67%
Entrez Gene ID: 83874
Uniprot ID: Q9BXI6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KPKPPKQAQKEQRKQMKGRGQLEKPPAPNQAMVVAAAGDACPPQHVPPKDSAPKDSAPQDLAPQVSAHHRSQESLTSQESEDTYL
• Gene Sequence: KPKPPKQAQKEQRKQMKGRGQLEKPPAPNQAMVVAAAGDACPPQHVPPKDSAPKDSAPQDLAPQVSAHHRSQESLTSQESEDTYL
• Gene ID - Mouse: ENSMUSG00000034412
• Gene ID - Rat: ENSRNOG00000006394
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.