Anti TARM1 pAb (ATL-HPA054401)

Atlas Antibodies

SKU: ATL-HPA054401-25

• 

Protein Description: T cell-interacting, activating receptor on myeloid cells 1
Gene Name: TARM1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000053338: 44%, ENSRNOG00000055581: 49%
Entrez Gene ID: 441864
Uniprot ID: B6A8C7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RGVSFVLRKGGIILESPKPLDSTEGAAEFHLNNLKVRNAGEYTCEYYRKASPHILSQRSDVLLLLVTGHLSKPFLRTYQRGTVT
• Gene Sequence: RGVSFVLRKGGIILESPKPLDSTEGAAEFHLNNLKVRNAGEYTCEYYRKASPHILSQRSDVLLLLVTGHLSKPFLRTYQRGTVT
• Gene ID - Mouse: ENSMUSG00000053338
• Gene ID - Rat: ENSRNOG00000055581
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.