Protein Description: TAR (HIV-1) RNA binding protein 2
Gene Name: TARBP2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023051: 89%, ENSRNOG00000042355: 88%
Entrez Gene ID: 6895
Uniprot ID: Q15633
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: TARBP2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023051: 89%, ENSRNOG00000042355: 88%
Entrez Gene ID: 6895
Uniprot ID: Q15633
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | TVGDTSCTGQGPSKKAAKHKAAEVALKHLKGGSMLEPALEDSSSFSPLDSSLPEDIPVFTAAAAAT |
| Documents & Links for Anti TARBP2 pAb (ATL-HPA051181) | |
| Datasheet | Anti TARBP2 pAb (ATL-HPA051181) Datasheet (External Link) |
| Vendor Page | Anti TARBP2 pAb (ATL-HPA051181) at Atlas |
| Documents & Links for Anti TARBP2 pAb (ATL-HPA051181) | |
| Datasheet | Anti TARBP2 pAb (ATL-HPA051181) Datasheet (External Link) |
| Vendor Page | Anti TARBP2 pAb (ATL-HPA051181) |
| Citations for Anti TARBP2 pAb (ATL-HPA051181) – 1 Found |
| Oi, Ryoko; Koizumi, Hirotaka; Maeda, Ichiro; Noguchi, Akira; Tatsunami, Shinobu; Iwatani, Tsuguo; Kawamoto, Hisanori; Tsugawa, Koichiro; Takagi, Masayuki. Clinicopathological Significance of TARBP2, APP, and ZNF395 in Breast Cancer. Breast Cancer : Basic And Clinical Research. 10( 27980417):211-221. PubMed |