Protein Description: TAF5-like RNA polymerase II, p300/CBP-associated factor (PCAF)-associated factor, 65kDa
Gene Name: TAF5L
Alternative Gene Name: PAF65B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038697: 91%, ENSRNOG00000011234: 91%
Entrez Gene ID: 27097
Uniprot ID: O75529
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: TAF5L
Alternative Gene Name: PAF65B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038697: 91%, ENSRNOG00000011234: 91%
Entrez Gene ID: 27097
Uniprot ID: O75529
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | NFKLRAFLDNKYVVRLQEDSYNYLIRYLQSDNNTALCKVLTLHIHLDVQPAKRTDYQLYASGSSSRSENNGLEPPDMPSPILQNEAALEVLQESIKRVKDGPP |
Documents & Links for Anti TAF5L pAb (ATL-HPA067941) | |
Datasheet | Anti TAF5L pAb (ATL-HPA067941) Datasheet (External Link) |
Vendor Page | Anti TAF5L pAb (ATL-HPA067941) at Atlas |
Documents & Links for Anti TAF5L pAb (ATL-HPA067941) | |
Datasheet | Anti TAF5L pAb (ATL-HPA067941) Datasheet (External Link) |
Vendor Page | Anti TAF5L pAb (ATL-HPA067941) |