Anti TAF5L pAb (ATL-HPA067941)

Atlas Antibodies

SKU:
ATL-HPA067941-25
  • Immunofluorescent staining of human cell line U-251 MG shows localization to nuclear speckles.
  • Western blot analysis in human placenta tissue.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: TAF5-like RNA polymerase II, p300/CBP-associated factor (PCAF)-associated factor, 65kDa
Gene Name: TAF5L
Alternative Gene Name: PAF65B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038697: 91%, ENSRNOG00000011234: 91%
Entrez Gene ID: 27097
Uniprot ID: O75529
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NFKLRAFLDNKYVVRLQEDSYNYLIRYLQSDNNTALCKVLTLHIHLDVQPAKRTDYQLYASGSSSRSENNGLEPPDMPSPILQNEAALEVLQESIKRVKDGPP
Gene Sequence NFKLRAFLDNKYVVRLQEDSYNYLIRYLQSDNNTALCKVLTLHIHLDVQPAKRTDYQLYASGSSSRSENNGLEPPDMPSPILQNEAALEVLQESIKRVKDGPP
Gene ID - Mouse ENSMUSG00000038697
Gene ID - Rat ENSRNOG00000011234
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti TAF5L pAb (ATL-HPA067941)
Datasheet Anti TAF5L pAb (ATL-HPA067941) Datasheet (External Link)
Vendor Page Anti TAF5L pAb (ATL-HPA067941) at Atlas Antibodies

Documents & Links for Anti TAF5L pAb (ATL-HPA067941)
Datasheet Anti TAF5L pAb (ATL-HPA067941) Datasheet (External Link)
Vendor Page Anti TAF5L pAb (ATL-HPA067941)