Anti TAF1D pAb (ATL-HPA060385)

Atlas Antibodies

SKU: ATL-HPA060385-25

• 

Protein Description: TATA box binding protein (TBP)-associated factor, RNA polymerase I, D, 41kDa
Gene Name: TAF1D
Alternative Gene Name: JOSD3, MGC5306, TAF(I)41
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031939: 63%, ENSRNOG00000010921: 63%
Entrez Gene ID: 79101
Uniprot ID: Q9H5J8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: YQPTGRPRGRPEGRRNPIYSLIDKKKQFRSRGSGFPFLESENEKNAPWRKILTFEQAVARGFFNYIEKLKYEHHL
• Gene Sequence: YQPTGRPRGRPEGRRNPIYSLIDKKKQFRSRGSGFPFLESENEKNAPWRKILTFEQAVARGFFNYIEKLKYEHHL
• Gene ID - Mouse: ENSMUSG00000031939
• Gene ID - Rat: ENSRNOG00000010921
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.