Protein Description: TATA box binding protein (TBP)-associated factor, RNA polymerase I, C, 110kDa
Gene Name: TAF1C
Alternative Gene Name: MGC:39976, SL1, TAFI110, TAFI95
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031832: 81%, ENSRNOG00000015632: 78%
Entrez Gene ID: 9013
Uniprot ID: Q15572
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: TAF1C
Alternative Gene Name: MGC:39976, SL1, TAFI110, TAFI95
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031832: 81%, ENSRNOG00000015632: 78%
Entrez Gene ID: 9013
Uniprot ID: Q15572
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | FRDSSSWRWADFTAHPRVLTVGDRTGVKMLDTQGPPGCGLLLFRLGAEASCQKGERVLLTQYLGHSSPKCLPPTLHLVCTQFSLYLVDE |
Documents & Links for Anti TAF1C pAb (ATL-HPA072229) | |
Datasheet | Anti TAF1C pAb (ATL-HPA072229) Datasheet (External Link) |
Vendor Page | Anti TAF1C pAb (ATL-HPA072229) at Atlas |
Documents & Links for Anti TAF1C pAb (ATL-HPA072229) | |
Datasheet | Anti TAF1C pAb (ATL-HPA072229) Datasheet (External Link) |
Vendor Page | Anti TAF1C pAb (ATL-HPA072229) |