Protein Description: transcriptional adaptor 2A
Gene Name: TADA2A
Alternative Gene Name: ADA2, ADA2A, hADA2, TADA2L
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000018651: 97%, ENSRNOG00000002757: 99%
Entrez Gene ID: 6871
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: TADA2A
Alternative Gene Name: ADA2, ADA2A, hADA2, TADA2L
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000018651: 97%, ENSRNOG00000002757: 99%
Entrez Gene ID: 6871
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | MDRLGPFSNDPSDKPPCRGCSSYLMEPYIKCAECGPPPFFLCLQCFTRGFEYKKHQSDHTYEIMTSD |
Gene ID - Mouse | ENSMUSG00000018651 |
Gene ID - Rat | ENSMUSG00000018651 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti TADA2A pAb (ATL-HPA076497) | |
Datasheet | Anti TADA2A pAb (ATL-HPA076497) Datasheet (External Link) |
Vendor Page | Anti TADA2A pAb (ATL-HPA076497) at Atlas |
Documents & Links for Anti TADA2A pAb (ATL-HPA076497) | |
Datasheet | Anti TADA2A pAb (ATL-HPA076497) Datasheet (External Link) |
Vendor Page | Anti TADA2A pAb (ATL-HPA076497) |