Anti TACC2 pAb (ATL-HPA061394)

Atlas Antibodies

SKU: ATL-HPA061394-25

• 
• 

Protein Description: transforming, acidic coiled-coil containing protein 2
Gene Name: TACC2
Alternative Gene Name: AZU-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030852: 90%, ENSRNOG00000020457: 90%
Entrez Gene ID: 10579
Uniprot ID: O95359
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LSTFVNETKFSSPTEELDYRNSYEIEYMEKIGSSLPQDDDAPKKQALYLMFDTSQESPVKSSPVRMSESPTPCSGSSF
• Gene Sequence: LSTFVNETKFSSPTEELDYRNSYEIEYMEKIGSSLPQDDDAPKKQALYLMFDTSQESPVKSSPVRMSESPTPCSGSSF
• Gene ID - Mouse: ENSMUSG00000030852
• Gene ID - Rat: ENSRNOG00000020457
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.