Protein Description: TGF-beta activated kinase 1/MAP3K7 binding protein 2
Gene Name: TAB2
Alternative Gene Name: KIAA0733, MAP3K7IP2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000015755: 94%, ENSRNOG00000016054: 96%
Entrez Gene ID: 23118
Uniprot ID: Q9NYJ8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: TAB2
Alternative Gene Name: KIAA0733, MAP3K7IP2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000015755: 94%, ENSRNOG00000016054: 96%
Entrez Gene ID: 23118
Uniprot ID: Q9NYJ8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | QLQIDIDCLTKEIDLFQARGPHFNPSAIHNFYDNIGFVGPVPPKPKDQRSIIKTPKTQDTEDDEGAQWNC |
Documents & Links for Anti TAB2 pAb (ATL-HPA065436) | |
Datasheet | Anti TAB2 pAb (ATL-HPA065436) Datasheet (External Link) |
Vendor Page | Anti TAB2 pAb (ATL-HPA065436) at Atlas |
Documents & Links for Anti TAB2 pAb (ATL-HPA065436) | |
Datasheet | Anti TAB2 pAb (ATL-HPA065436) Datasheet (External Link) |
Vendor Page | Anti TAB2 pAb (ATL-HPA065436) |