Anti TAB1 pAb (ATL-HPA057104)

Atlas Antibodies

SKU: ATL-HPA057104-25

• 

Protein Description: TGF-beta activated kinase 1/MAP3K7 binding protein 1
Gene Name: TAB1
Alternative Gene Name: MAP3K7IP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022414: 99%, ENSRNOG00000017285: 97%
Entrez Gene ID: 10454
Uniprot ID: Q15750
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EQQPSWTDDLPLCHLSGVGSASNRSYSADGKGTESHPPEDSWLKFRSENNCFLYGVFNGYDGNRVTNFVAQ
• Gene Sequence: EQQPSWTDDLPLCHLSGVGSASNRSYSADGKGTESHPPEDSWLKFRSENNCFLYGVFNGYDGNRVTNFVAQ
• Gene ID - Mouse: ENSMUSG00000022414
• Gene ID - Rat: ENSRNOG00000017285
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.