Anti TAB1 pAb (ATL-HPA057104)
Atlas Antibodies
- SKU:
- ATL-HPA057104-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: TAB1
Alternative Gene Name: MAP3K7IP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022414: 99%, ENSRNOG00000017285: 97%
Entrez Gene ID: 10454
Uniprot ID: Q15750
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | EQQPSWTDDLPLCHLSGVGSASNRSYSADGKGTESHPPEDSWLKFRSENNCFLYGVFNGYDGNRVTNFVAQ |
Gene Sequence | EQQPSWTDDLPLCHLSGVGSASNRSYSADGKGTESHPPEDSWLKFRSENNCFLYGVFNGYDGNRVTNFVAQ |
Gene ID - Mouse | ENSMUSG00000022414 |
Gene ID - Rat | ENSRNOG00000017285 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti TAB1 pAb (ATL-HPA057104) | |
Datasheet | Anti TAB1 pAb (ATL-HPA057104) Datasheet (External Link) |
Vendor Page | Anti TAB1 pAb (ATL-HPA057104) at Atlas Antibodies |
Documents & Links for Anti TAB1 pAb (ATL-HPA057104) | |
Datasheet | Anti TAB1 pAb (ATL-HPA057104) Datasheet (External Link) |
Vendor Page | Anti TAB1 pAb (ATL-HPA057104) |