Protein Description: synaptotagmin 12
Gene Name: SYT12
Alternative Gene Name: SRG1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049303: 99%, ENSRNOG00000019306: 99%
Entrez Gene ID: 91683
Uniprot ID: Q8IV01
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: SYT12
Alternative Gene Name: SRG1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049303: 99%, ENSRNOG00000019306: 99%
Entrez Gene ID: 91683
Uniprot ID: Q8IV01
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | FESCFMRVSLLPDEQIVGISRIQRNAYSIFFDEKFSIPLDPTALEEKSLRFSVFGIDEDERNVSTGVVELKLSVLDLPLQPFSGWLYLQDQNKAADA |
| Documents & Links for Anti SYT12 pAb (ATL-HPA074255) | |
| Datasheet | Anti SYT12 pAb (ATL-HPA074255) Datasheet (External Link) |
| Vendor Page | Anti SYT12 pAb (ATL-HPA074255) at Atlas |
| Documents & Links for Anti SYT12 pAb (ATL-HPA074255) | |
| Datasheet | Anti SYT12 pAb (ATL-HPA074255) Datasheet (External Link) |
| Vendor Page | Anti SYT12 pAb (ATL-HPA074255) |