Anti SYT12 pAb (ATL-HPA074255)

Atlas Antibodies

SKU: ATL-HPA074255-25

• 

Product Description

Protein Description: synaptotagmin 12
Gene Name: SYT12
Alternative Gene Name: SRG1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049303: 99%, ENSRNOG00000019306: 99%
Entrez Gene ID: 91683
Uniprot ID: Q8IV01
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: FESCFMRVSLLPDEQIVGISRIQRNAYSIFFDEKFSIPLDPTALEEKSLRFSVFGIDEDERNVSTGVVELKLSVLDLPLQPFSGWLYLQDQNKAADA
• Gene Sequence: FESCFMRVSLLPDEQIVGISRIQRNAYSIFFDEKFSIPLDPTALEEKSLRFSVFGIDEDERNVSTGVVELKLSVLDLPLQPFSGWLYLQDQNKAADA
• Gene ID - Mouse: ENSMUSG00000049303
• Gene ID - Rat: ENSRNOG00000019306
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links