Anti SYT10 pAb (ATL-HPA055426)

Atlas Antibodies

SKU:
ATL-HPA055426-25
  • Immunohistochemical staining of human pancreas shows strong cytoplasmic positivity in subset of cells in islets of Langerhans.
  • Immunofluorescent staining of human cell line MCF7 shows localization to nucleoplasm & vesicles.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: synaptotagmin X
Gene Name: SYT10
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000063260: 83%, ENSRNOG00000014296: 83%
Entrez Gene ID: 341359
Uniprot ID: Q6XYQ8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MSFHKEDGVNSLCQKALHIVTELCFAGQVEWEKCSGIFPRDRGSQGGSSTDIS
Gene Sequence MSFHKEDGVNSLCQKALHIVTELCFAGQVEWEKCSGIFPRDRGSQGGSSTDIS
Gene ID - Mouse ENSMUSG00000063260
Gene ID - Rat ENSRNOG00000014296
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti SYT10 pAb (ATL-HPA055426)
Datasheet Anti SYT10 pAb (ATL-HPA055426) Datasheet (External Link)
Vendor Page Anti SYT10 pAb (ATL-HPA055426) at Atlas Antibodies

Documents & Links for Anti SYT10 pAb (ATL-HPA055426)
Datasheet Anti SYT10 pAb (ATL-HPA055426) Datasheet (External Link)
Vendor Page Anti SYT10 pAb (ATL-HPA055426)