Anti SYS1 pAb (ATL-HPA046716)

Atlas Antibodies

SKU:
ATL-HPA046716-25
  • Immunohistochemical staining of human kidney shows moderate granular cytoplasmic positivity in cells in tubules.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: Sys1 golgi trafficking protein
Gene Name: SYS1
Alternative Gene Name: C20orf169, dJ453C12.4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000090996: 97%, ENSRNOG00000014480: 97%
Entrez Gene ID: 90196
Uniprot ID: Q8N2H4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LVDGLVRSSPSLDQMFDAEILGFSTPPGRLSM
Gene Sequence LVDGLVRSSPSLDQMFDAEILGFSTPPGRLSM
Gene ID - Mouse ENSMUSG00000090996
Gene ID - Rat ENSRNOG00000014480
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti SYS1 pAb (ATL-HPA046716)
Datasheet Anti SYS1 pAb (ATL-HPA046716) Datasheet (External Link)
Vendor Page Anti SYS1 pAb (ATL-HPA046716) at Atlas Antibodies

Documents & Links for Anti SYS1 pAb (ATL-HPA046716)
Datasheet Anti SYS1 pAb (ATL-HPA046716) Datasheet (External Link)
Vendor Page Anti SYS1 pAb (ATL-HPA046716)