Protein Description: synaptophysin like 2
Gene Name: SYPL2
Alternative Gene Name: Mg29
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027887: 78%, ENSRNOG00000019780: 78%
Entrez Gene ID: 284612
Uniprot ID: Q5VXT5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: SYPL2
Alternative Gene Name: Mg29
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027887: 78%, ENSRNOG00000019780: 78%
Entrez Gene ID: 284612
Uniprot ID: Q5VXT5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | FKETPWHGQGQGQDQDQDQDQGQGPSQESAAEQGAVE |
Documents & Links for Anti SYPL2 pAb (ATL-HPA076657) | |
Datasheet | Anti SYPL2 pAb (ATL-HPA076657) Datasheet (External Link) |
Vendor Page | Anti SYPL2 pAb (ATL-HPA076657) at Atlas |
Documents & Links for Anti SYPL2 pAb (ATL-HPA076657) | |
Datasheet | Anti SYPL2 pAb (ATL-HPA076657) Datasheet (External Link) |
Vendor Page | Anti SYPL2 pAb (ATL-HPA076657) |