Anti SYNPO2L pAb (ATL-HPA055192 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA055192-25
  • Immunohistochemistry analysis in human heart muscle and skin tissues using Anti-SYNPO2L antibody. Corresponding SYNPO2L RNA-seq data are presented for the same tissues.
  • Immunofluorescent staining of human cell line CACO-2 shows localization to nuclear speckles & cell junctions.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: synaptopodin 2-like
Gene Name: SYNPO2L
Alternative Gene Name: FLJ12921
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039376: 97%, ENSRNOG00000008949: 99%
Entrez Gene ID: 79933
Uniprot ID: Q9H987
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PAEALLLPHGPLRPGPHLIPMVGPVPHPVAEDLTTTYTQKAKQAKLQRAESLQEKSIKEAKTKCRTIASLLTA
Gene Sequence PAEALLLPHGPLRPGPHLIPMVGPVPHPVAEDLTTTYTQKAKQAKLQRAESLQEKSIKEAKTKCRTIASLLTA
Gene ID - Mouse ENSMUSG00000039376
Gene ID - Rat ENSRNOG00000008949
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.



Documents & Links for Anti SYNPO2L pAb (ATL-HPA055192 w/enhanced validation)
Datasheet Anti SYNPO2L pAb (ATL-HPA055192 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti SYNPO2L pAb (ATL-HPA055192 w/enhanced validation)