Anti SYNDIG1L pAb (ATL-HPA048487)

Atlas Antibodies

SKU: ATL-HPA048487-25

• 

Protein Description: synapse differentiation inducing 1-like
Gene Name: SYNDIG1L
Alternative Gene Name: capucin, IFITMD4, TMEM90A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000071234: 75%, ENSRNOG00000027645: 76%
Entrez Gene ID: 646658
Uniprot ID: A6NDD5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RAGSCETSFTEDREPQEGPPEQPTGPGQAAENVTIQTVSYGVQEELRDQEDDQEEEESDATSTESESEDNFLTLP
• Gene Sequence: RAGSCETSFTEDREPQEGPPEQPTGPGQAAENVTIQTVSYGVQEELRDQEDDQEEEESDATSTESESEDNFLTLP
• Gene ID - Mouse: ENSMUSG00000071234
• Gene ID - Rat: ENSRNOG00000027645
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.