Anti SYNC pAb (ATL-HPA063549 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA063549-25
  • Immunohistochemistry analysis in human skeletal muscle and pancreas tissues using Anti-SYNC antibody. Corresponding SYNC RNA-seq data are presented for the same tissues.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: syncoilin, intermediate filament protein
Gene Name: SYNC
Alternative Gene Name: SYNC1, SYNCOILIN
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000001333: 51%, ENSRNOG00000008118: 58%
Entrez Gene ID: 81493
Uniprot ID: Q9H7C4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ARKTRVEANSPLPKNSGSLNEAEALNPEVTLSSEGSLNLEDILYLEDTGDLDETLYVQETEKAEEALYIEEAMQPDE
Gene Sequence ARKTRVEANSPLPKNSGSLNEAEALNPEVTLSSEGSLNLEDILYLEDTGDLDETLYVQETEKAEEALYIEEAMQPDE
Gene ID - Mouse ENSMUSG00000001333
Gene ID - Rat ENSRNOG00000008118
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti SYNC pAb (ATL-HPA063549 w/enhanced validation)
Datasheet Anti SYNC pAb (ATL-HPA063549 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti SYNC pAb (ATL-HPA063549 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti SYNC pAb (ATL-HPA063549 w/enhanced validation)
Datasheet Anti SYNC pAb (ATL-HPA063549 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti SYNC pAb (ATL-HPA063549 w/enhanced validation)