Anti SYDE2 pAb (ATL-HPA058378)

Atlas Antibodies

SKU: ATL-HPA058378-25

• 

Protein Description: synapse defective 1, Rho GTPase, homolog 2 (C. elegans)
Gene Name: SYDE2
Alternative Gene Name: FLJ13815
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036863: 67%, ENSRNOG00000026186: 66%
Entrez Gene ID: 84144
Uniprot ID: Q5VT97
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: NDVDYDDVPSEDRKIGENYSKMDGPEVMIEQPIPMSKECTFQTYLTMQTIESTVDRKNNLKDLQESIDTLIGN
• Gene Sequence: NDVDYDDVPSEDRKIGENYSKMDGPEVMIEQPIPMSKECTFQTYLTMQTIESTVDRKNNLKDLQESIDTLIGN
• Gene ID - Mouse: ENSMUSG00000036863
• Gene ID - Rat: ENSRNOG00000026186
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.