Protein Description: synaptonemal complex protein 2
Gene Name: SYCP2
Alternative Gene Name: SCP2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000060445: 41%, ENSRNOG00000061690: 40%
Entrez Gene ID: 10388
Uniprot ID: Q9BX26
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: SYCP2
Alternative Gene Name: SCP2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000060445: 41%, ENSRNOG00000061690: 40%
Entrez Gene ID: 10388
Uniprot ID: Q9BX26
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | GERRANLLPKKLCKIEDADHHIHKMSESVSSLSTNDFSIPWETWQNEFAGIEMTYETYERLNSEFKRRNNIRHKMLSYFTTQSWKTAQQHLRTMNHQSQDSRI |
| Documents & Links for Anti SYCP2 pAb (ATL-HPA065613) | |
| Datasheet | Anti SYCP2 pAb (ATL-HPA065613) Datasheet (External Link) |
| Vendor Page | Anti SYCP2 pAb (ATL-HPA065613) at Atlas |
| Documents & Links for Anti SYCP2 pAb (ATL-HPA065613) | |
| Datasheet | Anti SYCP2 pAb (ATL-HPA065613) Datasheet (External Link) |
| Vendor Page | Anti SYCP2 pAb (ATL-HPA065613) |