Anti SYCE3 pAb (ATL-HPA047813)

Atlas Antibodies

SKU:
ATL-HPA047813-25
  • Immunofluorescent staining of human cell line SH-SY5Y shows localization to nucleus, nucleoli & the Golgi apparatus.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: synaptonemal complex central element protein 3
Gene Name: SYCE3
Alternative Gene Name: C22orf41
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000078938: 92%, ENSRNOG00000042056: 91%
Entrez Gene ID: 644186
Uniprot ID: A1L190
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DADPEERNYDNMLKMLSDLNKDLEKLLEEMEKISVQATWMAYDMVVMRTNPTLAESMRRLEDAFVNCKEEMEKNWQELLHETKQR
Gene Sequence DADPEERNYDNMLKMLSDLNKDLEKLLEEMEKISVQATWMAYDMVVMRTNPTLAESMRRLEDAFVNCKEEMEKNWQELLHETKQR
Gene ID - Mouse ENSMUSG00000078938
Gene ID - Rat ENSRNOG00000042056
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti SYCE3 pAb (ATL-HPA047813)
Datasheet Anti SYCE3 pAb (ATL-HPA047813) Datasheet (External Link)
Vendor Page Anti SYCE3 pAb (ATL-HPA047813) at Atlas Antibodies

Documents & Links for Anti SYCE3 pAb (ATL-HPA047813)
Datasheet Anti SYCE3 pAb (ATL-HPA047813) Datasheet (External Link)
Vendor Page Anti SYCE3 pAb (ATL-HPA047813)