Anti SYAP1 pAb (ATL-HPA048047)

Atlas Antibodies

SKU:
ATL-HPA048047-25
  • Immunofluorescent staining of human cell line HEK 293 shows localization to nucleoplasm, cytosol & the Golgi apparatus.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: synapse associated protein 1
Gene Name: SYAP1
Alternative Gene Name: FLJ14495, PRO3113
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031357: 75%, ENSRNOG00000004304: 78%
Entrez Gene ID: 94056
Uniprot ID: Q96A49
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TVAESAEEELQQAGDQELLHQAKDFGNYLFNFASAATKKITESVAETAQTIKKSVEEGKIDGIIDKTIIGDFQKEQKKFVEEQHTKKSEAAVPPWVDTND
Gene Sequence TVAESAEEELQQAGDQELLHQAKDFGNYLFNFASAATKKITESVAETAQTIKKSVEEGKIDGIIDKTIIGDFQKEQKKFVEEQHTKKSEAAVPPWVDTND
Gene ID - Mouse ENSMUSG00000031357
Gene ID - Rat ENSRNOG00000004304
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti SYAP1 pAb (ATL-HPA048047)
Datasheet Anti SYAP1 pAb (ATL-HPA048047) Datasheet (External Link)
Vendor Page Anti SYAP1 pAb (ATL-HPA048047) at Atlas Antibodies

Documents & Links for Anti SYAP1 pAb (ATL-HPA048047)
Datasheet Anti SYAP1 pAb (ATL-HPA048047) Datasheet (External Link)
Vendor Page Anti SYAP1 pAb (ATL-HPA048047)