Anti SWI5 pAb (ATL-HPA055472)

Atlas Antibodies

SKU:
ATL-HPA055472-25
  • Immunofluorescent staining of human cell line U-2 OS shows localization to nucleus.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: SWI5 homologous recombination repair protein
Gene Name: SWI5
Alternative Gene Name: bA395P17.9, C9orf119, SAE3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031922: 29%, ENSRNOG00000003736: 30%
Entrez Gene ID: 375757
Uniprot ID: Q1ZZU3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MQRRGQRDLWRHNKSCARNRCPRPPRERGGAGFPWVRAQLSVRQFTLRVRVPGPVHLRGRSPTPALDPLAPLN
Gene Sequence MQRRGQRDLWRHNKSCARNRCPRPPRERGGAGFPWVRAQLSVRQFTLRVRVPGPVHLRGRSPTPALDPLAPLN
Gene ID - Mouse ENSMUSG00000031922
Gene ID - Rat ENSRNOG00000003736
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti SWI5 pAb (ATL-HPA055472)
Datasheet Anti SWI5 pAb (ATL-HPA055472) Datasheet (External Link)
Vendor Page Anti SWI5 pAb (ATL-HPA055472) at Atlas Antibodies

Documents & Links for Anti SWI5 pAb (ATL-HPA055472)
Datasheet Anti SWI5 pAb (ATL-HPA055472) Datasheet (External Link)
Vendor Page Anti SWI5 pAb (ATL-HPA055472)