Anti SWI5 pAb (ATL-HPA052032)

Atlas Antibodies

SKU: ATL-HPA052032-25

• 
• 

Protein Description: SWI5 recombination repair homolog (yeast)
Gene Name: SWI5
Alternative Gene Name: bA395P17.9, C9orf119
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000044627: 76%, ENSRNOG00000022860: 78%
Entrez Gene ID: 375757
Uniprot ID: Q1ZZU3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: HLDIQKLKEKRDMLDKEISQFVSEGYSVDELEDHITQLHEYNDIKDVGQMLMGKLAVIRGVTTKELYPEFGL
• Gene Sequence: HLDIQKLKEKRDMLDKEISQFVSEGYSVDELEDHITQLHEYNDIKDVGQMLMGKLAVIRGVTTKELYPEFGL
• Gene ID - Mouse: ENSMUSG00000044627
• Gene ID - Rat: ENSRNOG00000022860
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.