Anti SUZ12 pAb (ATL-HPA057436)

Atlas Antibodies

SKU: ATL-HPA057436-25

• 
• 
• 

Protein Description: SUZ12 polycomb repressive complex 2 subunit
Gene Name: SUZ12
Alternative Gene Name: CHET9, JJAZ1, KIAA0160
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000017548: 96%, ENSRNOG00000058663: 90%
Entrez Gene ID: 23512
Uniprot ID: Q15022
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: NKPGSVKPTQTIAVKESLTTDLQTRKEKDTPNENRQKLRIFYQFLYNNNTRQQTEARDDLHCPWCTLNCRKLYSLLKHLKLCHSRFIFNYVYHPKGARIDVSINECYDGSYAGNPQDIHRQPGFAFSRNGPVKRTPIT
• Gene Sequence: NKPGSVKPTQTIAVKESLTTDLQTRKEKDTPNENRQKLRIFYQFLYNNNTRQQTEARDDLHCPWCTLNCRKLYSLLKHLKLCHSRFIFNYVYHPKGARIDVSINECYDGSYAGNPQDIHRQPGFAFSRNGPVKRTPIT
• Gene ID - Mouse: ENSMUSG00000017548
• Gene ID - Rat: ENSRNOG00000058663
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti SUZ12 pAb (ATL-HPA057436) – 1 Found

Bremer, Sebastian C B; Bittner, Gabi; Elakad, Omar; Dinter, Helen; Gaedcke, Jochen; König, Alexander O; Amanzada, Ahmad; Ellenrieder, Volker; Freiherr von Hammerstein-Equord, Alexander; Ströbel, Philipp; Bohnenberger, Hanibal. Enhancer of Zeste Homolog 2 (EZH2) Is a Marker of High-Grade Neuroendocrine Neoplasia in Gastroenteropancreatic and Pulmonary Tract and Predicts Poor Prognosis. Cancers. 2022;14(12)