Anti SUV39H2 pAb (ATL-HPA057554 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA057554-25
  • Immunohistochemistry analysis in human testis and endometrium tissues using Anti-SUV39H2 antibody. Corresponding SUV39H2 RNA-seq data are presented for the same tissues.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: suppressor of variegation 3-9 homolog 2 (Drosophila)
Gene Name: SUV39H2
Alternative Gene Name: FLJ23414, KMT1B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026646: 87%, ENSRNOG00000015585: 87%
Entrez Gene ID: 79723
Uniprot ID: Q9H5I1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NTVDLEGPPSDFYYINEYKPAPGISLVNEATFGCSCTDCFFQKCCPAEAGVLLAYNKNQQIKIPPGTPI
Gene Sequence NTVDLEGPPSDFYYINEYKPAPGISLVNEATFGCSCTDCFFQKCCPAEAGVLLAYNKNQQIKIPPGTPI
Gene ID - Mouse ENSMUSG00000026646
Gene ID - Rat ENSRNOG00000015585
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.



Documents & Links for Anti SUV39H2 pAb (ATL-HPA057554 w/enhanced validation)
Datasheet Anti SUV39H2 pAb (ATL-HPA057554 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti SUV39H2 pAb (ATL-HPA057554 w/enhanced validation)



Citations for Anti SUV39H2 pAb (ATL-HPA057554 w/enhanced validation) – 1 Found
Kochin, Vitaly; Kanaseki, Takayuki; Tokita, Serina; Miyamoto, Sho; Shionoya, Yosuke; Kikuchi, Yasuhiro; Morooka, Daichi; Hirohashi, Yoshihiko; Tsukahara, Tomohide; Watanabe, Kazue; Toji, Shingo; Kokai, Yasuo; Sato, Noriyuki; Torigoe, Toshihiko. HLA-A24 ligandome analysis of colon and lung cancer cells identifies a novel cancer-testis antigen and a neoantigen that elicits specific and strong CTL responses. Oncoimmunology. 6(4):e1293214.  PubMed