Anti SUPT16H pAb (ATL-HPA049787 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA049787-25
  • Immunohistochemistry analysis in human testis and liver tissues using HPA049787 antibody. Corresponding SUPT16H RNA-seq data are presented for the same tissues.
  • Immunofluorescent staining of human cell line U-2 OS shows localization to nucleus.
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: suppressor of Ty 16 homolog (S. cerevisiae)
Gene Name: SUPT16H
Alternative Gene Name: CDC68, FACT, FACTP140, FLJ10857, FLJ14010, SPT16/CDC68
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035726: 100%, ENSRNOG00000011953: 100%
Entrez Gene ID: 11198
Uniprot ID: Q9Y5B9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ASITSEVFNKFFKERVMEIVDADEKVRHSKLAESVEKAIEEKKYLAGADPSTVEMCYPPIIQSGGNYNLKFSVVSDKNHMHFGAITCAMGIRFKSY
Gene Sequence ASITSEVFNKFFKERVMEIVDADEKVRHSKLAESVEKAIEEKKYLAGADPSTVEMCYPPIIQSGGNYNLKFSVVSDKNHMHFGAITCAMGIRFKSY
Gene ID - Mouse ENSMUSG00000035726
Gene ID - Rat ENSRNOG00000011953
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.



Documents & Links for Anti SUPT16H pAb (ATL-HPA049787 w/enhanced validation)
Datasheet Anti SUPT16H pAb (ATL-HPA049787 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti SUPT16H pAb (ATL-HPA049787 w/enhanced validation)