Anti SUGP2 pAb (ATL-HPA061111 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA061111-25

• 
• 

Protein Description: SURP and G patch domain containing 2
Gene Name: SUGP2
Alternative Gene Name: KIAA0365, SFRS14
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036054: 73%, ENSRNOG00000020269: 71%
Entrez Gene ID: 10147
Uniprot ID: Q8IX01
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ESRDYDVDHPGEADSVLRGGSQVQARGRALNIVDQEGSLLGKGETQGLLTAKGGVGKLVTLRNVSTKKIPTVNRITPKTQGTNQIQKNTPSPDVTLG
• Gene Sequence: ESRDYDVDHPGEADSVLRGGSQVQARGRALNIVDQEGSLLGKGETQGLLTAKGGVGKLVTLRNVSTKKIPTVNRITPKTQGTNQIQKNTPSPDVTLG
• Gene ID - Mouse: ENSMUSG00000036054
• Gene ID - Rat: ENSRNOG00000020269
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.