Anti SUCLG2 pAb (ATL-HPA051998 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA051998-25
  • Immunohistochemical staining of human kidney, liver, pancreas and testis using Anti-SUCLG2 antibody HPA051998 (A) shows similar protein distribution across tissues to independent antibody HPA046705 (B).
  • Western blot analysis using Anti-SUCLG2 antibody HPA051998 (A) shows similar pattern to independent antibody HPA046705 (B).
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: succinate-CoA ligase, GDP-forming, beta subunit
Gene Name: SUCLG2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000061838: 97%, ENSRNOG00000005686: 96%
Entrez Gene ID: 8801
Uniprot ID: Q96I99
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AADQITKLYNLFLKIDATQVEVNPFGETPEGQVVCFDAKINFDDNAEFRQKDIFAMDDKSENEPIENEAAKYDL
Gene Sequence AADQITKLYNLFLKIDATQVEVNPFGETPEGQVVCFDAKINFDDNAEFRQKDIFAMDDKSENEPIENEAAKYDL
Gene ID - Mouse ENSMUSG00000061838
Gene ID - Rat ENSRNOG00000005686
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.



Documents & Links for Anti SUCLG2 pAb (ATL-HPA051998 w/enhanced validation)
Datasheet Anti SUCLG2 pAb (ATL-HPA051998 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti SUCLG2 pAb (ATL-HPA051998 w/enhanced validation)