Anti SUCLG2 pAb (ATL-HPA046705 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA046705-25

• 
• 
• 

Protein Description: succinate-CoA ligase, GDP-forming, beta subunit
Gene Name: SUCLG2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000061838: 94%, ENSRNOG00000005686: 93%
Entrez Gene ID: 8801
Uniprot ID: Q96I99
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: FGGIVNCAIIANGITKACRELELKVPLVVRLEGTNVQEAQKILNNSGLPITSAIDLEDAAKKAVASVAKK
• Gene Sequence: FGGIVNCAIIANGITKACRELELKVPLVVRLEGTNVQEAQKILNNSGLPITSAIDLEDAAKKAVASVAKK
• Gene ID - Mouse: ENSMUSG00000061838
• Gene ID - Rat: ENSRNOG00000005686
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti SUCLG2 pAb (ATL-HPA046705 w/enhanced validation) – 1 Found

Dobolyi, Arpad; Bago, Attila; Palkovits, Miklos; Nemeria, Natalia S; Jordan, Frank; Doczi, Judit; Ambrus, Attila; Adam-Vizi, Vera; Chinopoulos, Christos. Exclusive neuronal detection of KGDHC-specific subunits in the adult human brain cortex despite pancellular protein lysine succinylation. Brain Structure & Function. 2020;225(2):639-667.